Anti-Tyrosine Hydroxylase / TH

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31900 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. TH is equal to tyrosine hydroxylase. The... more
Product information "Anti-Tyrosine Hydroxylase / TH"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. TH is equal to tyrosine hydroxylase. The protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. In humans, tyrosine hydroxylase is encoded by the TH gene, and the enzyme is present in the central nervous system (CNS), peripheral sympathetic neurons and the adrenal medulla. Tyrosine hydroxylase, phenylalanine hydroxylase and tryptophan hydroxylase together make up the family of aromatic amino acid hydroxylases (AAAHs). Protein function: Catalyzes the conversion of L-tyrosine to L- dihydroxyphenylalanine (L-Dopa), the rate-limiting step in the biosynthesis of cathecolamines, dopamine, noradrenaline, and adrenaline. Uses tetrahydrobiopterin and molecular oxygen to convert tyrosine to L-Dopa (PubMed:17391063, PubMed:1680128, PubMed:15287903, PubMed:8528210, Ref.18, PubMed:34922205, PubMed:24753243). In addition to tyrosine, is able to catalyze the hydroxylation of phenylalanine and tryptophan with lower specificity. Positively regulates the regression of retinal hyaloid vessels during postnatal development. [The UniProt Consortium]
Keywords: Anti-TH, Anti-TYH, Anti-Tyrosine 3-hydroxylase, Anti-Tyrosine 3-monooxygenase, Tyrosine Hydroxylase Antibody / TH
Supplier: NSJ Bioreagents
Supplier-Nr: R31900

Properties

Application: WB, IHC (paraffin), IF
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse, rat
Immunogen: Amino acids KVPWFPRKVSELDKCHHLVTKFDPDLDLDH of human TH
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Tyrosine Hydroxylase / TH"
Write a review
or to review a product.
Viewed