Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| ARG40772.50 | 50 µl | - | - |
6 - 14 business days* |
584.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Protein function: Acts as a transcriptional regulator. Inhibits myogenesis by sequestrating E... more
Product information "Anti-Twist 1"
Protein function: Acts as a transcriptional regulator. Inhibits myogenesis by sequestrating E proteins, inhibiting trans-activation by MEF2, and inhibiting DNA-binding by MYOD1 through physical interaction. This interaction probably involves the basic domains of both proteins. Also represses expression of proinflammatory cytokines such as TNFA and IL1B. Regulates cranial suture patterning and fusion. Activates transcription as a heterodimer with E proteins. Regulates gene expression differentially, depending on dimer composition. Homodimers induce expression of FGFR2 and POSTN while heterodimers repress FGFR2 and POSTN expression and induce THBS1 expression. Heterodimerization is also required for osteoblast differentiation. Represses the activity of the circadian transcriptional activator: NPAS2-ARNTL/BMAL1 heterodimer. [The UniProt Consortium]
| Keywords: | Anti-TWIST1, Anti-bHLHa38, Anti-BHLHA38, Anti-H-twist, Anti-Twist-related protein 1, Anti-Class A basic helix-loop-helix protein 38 |
| Supplier: | Arigo Biolaboratories |
| Supplier-Nr: | ARG40772 |
Properties
| Application: | IHC (paraffin), WB |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human (Expected: mouse, rat, cow, dog, guinea pig, horse, swine, rabbit, zebrafish) |
| Immunogen: | Synthetic peptide around the C-terminal region of Human Twist 1 (within the following region: DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVW) |
| MW: | 20 kD |
| Format: | Purified |
Database Information
| KEGG ID : | K09069 | Matching products |
| UniProt ID : | Q15672 | Matching products |
| Gene ID : | GeneID 7291 | Matching products |
Handling & Safety
| Storage: | -20°C |
| Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed