Anti-Twist 1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40772.50 50 µl - -

6 - 14 business days*

584.00€
 
Protein function: Acts as a transcriptional regulator. Inhibits myogenesis by sequestrating E... more
Product information "Anti-Twist 1"
Protein function: Acts as a transcriptional regulator. Inhibits myogenesis by sequestrating E proteins, inhibiting trans-activation by MEF2, and inhibiting DNA-binding by MYOD1 through physical interaction. This interaction probably involves the basic domains of both proteins. Also represses expression of proinflammatory cytokines such as TNFA and IL1B. Regulates cranial suture patterning and fusion. Activates transcription as a heterodimer with E proteins. Regulates gene expression differentially, depending on dimer composition. Homodimers induce expression of FGFR2 and POSTN while heterodimers repress FGFR2 and POSTN expression and induce THBS1 expression. Heterodimerization is also required for osteoblast differentiation. Represses the activity of the circadian transcriptional activator: NPAS2-ARNTL/BMAL1 heterodimer. [The UniProt Consortium]
Keywords: Anti-TWIST1, Anti-bHLHa38, Anti-BHLHA38, Anti-H-twist, Anti-Twist-related protein 1, Anti-Class A basic helix-loop-helix protein 38
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40772

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, cow, dog, guinea pig, horse, swine, rabbit, zebrafish)
Immunogen: Synthetic peptide around the C-terminal region of Human Twist 1 (within the following region: DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVW)
MW: 20 kD
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Twist 1"
Write a review
or to review a product.
Viewed