Anti-TGFBR2 / TGF beta Receptor II

Anti-TGFBR2 / TGF beta Receptor II
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32086 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. TGFBR2 (Transforming growth factor, beta... more
Product information "Anti-TGFBR2 / TGF beta Receptor II"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. TGFBR2 (Transforming growth factor, beta receptor II) is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. It is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan syndrome, Loeys-Deitz aortic aneurysm syndrome, Osler-Weber-Rendu syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different informs have been characterized. Protein function: Transmembrane serine/threonine kinase forming with the TGF- beta type I serine/threonine kinase receptor, TGFBR1, the non- promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and thus regulates a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways. [The UniProt Consortium]
Keywords: Anti-TGFBR2, Anti-TGFR-2, Anti-TbetaR-II, EC=2.7.11.30, Anti-TGF-beta receptor type-2, Anti-TGF-beta type II receptor, Anti-TGF-beta receptor type II, Anti-Transforming growth factor-beta receptor type II, TGFBR2 Antibody / TGF beta Receptor II
Supplier: NSJ Bioreagents
Supplier-Nr: R32086

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK of human TGFBR2
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-TGFBR2 / TGF beta Receptor II"
Write a review
or to review a product.
Viewed