Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-R32276 | 100 µg | - | - |
3 - 10 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. STING Antibody targets stimulator of... more
Product information "Anti-STING / TMEM173"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. STING Antibody targets stimulator of interferon genes, encoded by the TMEM173 gene. Stimulator of interferon genes is an endoplasmic reticulum-associated adaptor protein that functions as a central regulator of innate immune signaling in response to cytosolic DNA. STING plays a critical role in host defense by linking intracellular DNA sensing to downstream inflammatory and antiviral responses, thereby coordinating early immune activation against pathogens and aberrant cellular processes.Functionally, stimulator of interferon genes is activated following binding of cyclic dinucleotides, including cyclic GMP-AMP generated by cyclic GMP-AMP synthase after detection of double stranded DNA in the cytoplasm. Ligand binding induces conformational changes in STING that promote its translocation from the endoplasmic reticulum to the Golgi apparatus and perinuclear vesicles. This trafficking step is essential for recruitment and activation of downstream signaling components such as TBK1, leading to phosphorylation of IRF3 and induction of type I interferons and interferon-stimulated genes. A STING Antibody supports studies focused on innate immune activation, antiviral signaling, and DNA sensing pathways.STING is expressed in a broad range of immune and non-immune cell types, including macrophages, dendritic cells, endothelial cells, fibroblasts, and epithelial cells. Expression levels and signaling competence can vary depending on cell type, developmental stage, and inflammatory context. Under basal conditions, STING is predominantly localized to the cytoplasmic face of the endoplasmic reticulum membrane, where it remains inactive until pathway stimulation occurs. Upon activation, dynamic changes in subcellular localization reflect the tightly regulated nature of STING signaling and its dependence on intracellular trafficking for proper signal propagation.At the molecular level, stimulator of interferon genes contains multiple transmembrane domains that anchor it within the endoplasmic reticulum, along with a cytosolic C-terminal domain responsible for ligand binding and interaction with downstream signaling proteins. These structural features enable STING to function as a scaffold that integrates DNA sensing with kinase activation and transcriptional regulation. Regulation of STING activity involves not only ligand binding but also post-translational modifications and protein-protein interactions that fine-tune signaling intensity and duration.From a disease relevance perspective, dysregulated STING signaling has been implicated in a wide range of pathological conditions. Gain-of-function mutations in TMEM173 are associated with autoinflammatory syndromes characterized by excessive interferon production and chronic inflammation. Conversely, impaired STING signaling can compromise antiviral immunity and reduce immune surveillance in cancer. STING pathway activation has therefore become an area of significant interest in oncology and immunology, with therapeutic strategies aimed at modulating STING activity to enhance antitumor immunity or suppress pathological inflammation. These disease associations underscore the importance of tightly controlled stimulator of interferon genes signaling in maintaining immune homeostasis.STING Antibody reagents enable investigation of innate immune signaling mechanisms, intracellular trafficking events, and inflammatory pathway regulation in both physiological and disease-associated contexts. Detection of STING expression and localization supports research into host defense, immune dysregulation, and therapeutic targeting of DNA sensing pathways, with NSJ Bioreagents providing antibodies intended for research use.
| Keywords: | Anti-STING1, Anti-Transmembrane protein 173, Anti-Mediator of IRF3 activation, Anti-Stimulator of interferon genes protein, Anti-Endoplasmic reticulum interferon stimulator, STING Antibody / TMEM173 |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | R32276 |
Properties
| Application: | WB, IHC (paraffin), FC |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
| Immunogen: | Amino acids RLEQAKLFCRTLEDILADAPESQNNCRLIAYQE of human STING |
| Format: | Purified |
Database Information
| KEGG ID : | K12654 | Matching products |
| UniProt ID : | Q86WV6 | Matching products |
| Gene ID : | GeneID 340061 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed