Anti-StAR / Steroidogenic acute regulatory protein

Anti-StAR / Steroidogenic acute regulatory protein
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4391 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The steroidogenic acute regulatory... more
Product information "Anti-StAR / Steroidogenic acute regulatory protein"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The steroidogenic acute regulatory protein, commonly referred to as StAR (STARD1), is a transport protein. This protein plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. It permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13. Protein function: Plays a key role in steroid hormone synthesis by enhancing the metabolism of cholesterol into pregnenolone. Mediates the transfer of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane where it is cleaved to pregnenolone. [The UniProt Consortium]
Keywords: Anti-StAR, Anti-STAR, Anti-STARD1, Anti-StARD1, Anti-START domain-containing protein 1, Anti-Steroidogenic acute regulatory protein, mitochondrial, StAR Antibody / Steroidogenic acute regulatory protein
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4391

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse, rat
Immunogen: Amino acids EETLYSDQELAYLQQGEEAMQKALGILSNQEGWKKESQQD from the human protein were used as the immunogen for the StAR antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-StAR / Steroidogenic acute regulatory protein"
Write a review
or to review a product.
Viewed