Anti-SKP2

Anti-SKP2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4170 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The F box protein Skp2 (S-phase... more
Product information "Anti-SKP2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The F box protein Skp2 (S-phase kinase-associated protein 2) is oncogenic, and its frequent amplification and overexpression correlate with the grade of malignancy of certain tumors. Skp2 controls p300-p53 signaling pathways in cancer cells, making it a potential molecular target for cancer therapy. This gene positively regulates the G(1)-S transition by controlling the stability of several G(1) regulators, such as the cell cycle inhibitor p27. This study provides evidence of a role for an F-box protein in oncogenesis and establishes SKP2 as a protooncogene causally involved in the pathogenesis of lymphomas. Protein function: Substrate recognition component of a SCF (SKP1-CUL1-F- box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Specifically recognizes phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. Degradation of CDKN1B/p27kip also requires CKS1. Recognizes target proteins ORC1, CDT1, RBL2, KMT2A/MLL1, CDK9, RAG2, FOXO1, UBP43, and probably MYC, TOB1 and TAL1. Degradation of TAL1 also requires STUB1. Recognizes CDKN1A in association with CCNE1 or CCNE2 and CDK2. Promotes ubiquitination and destruction of CDH1 in a CK1-Dependent Manner, thereby regulating cell migration. [The UniProt Consortium]
Keywords: Anti-SKP2, Anti-FBXL1, Anti-p45skp2, Anti-F-box protein Skp2, Anti-F-box/LRR-repeat protein 1, Anti-S-phase kinase-associated protein 2, Anti-Cyclin-A/CDK2-associated protein p45, SKP2 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4170

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids ETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHL were used as the immunogen for the SKP2 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SKP2"
Write a review
or to review a product.
Viewed