Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-RQ4920 | 100 µg | - | - |
7 - 12 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PTPN11 Antibody targets Tyrosine-protein... more
Product information "Anti-SHP2 / PTPN11, clone 2000000"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PTPN11 Antibody targets Tyrosine-protein phosphatase non-receptor type 11, also known as SHP2, a cytoplasmic protein tyrosine phosphatase encoded by the PTPN11 gene that plays a central role in intracellular signal transduction. SHP2 is a widely expressed signaling regulator that participates in multiple growth factor, cytokine, and hormone signaling pathways. Through its phosphatase activity and adaptor functions, SHP2 integrates extracellular cues with downstream cellular responses that control proliferation, differentiation, migration, and survival.Functionally, Tyrosine-protein phosphatase non-receptor type 11 contains two N-terminal SH2 domains that mediate binding to phosphorylated tyrosine residues on activated receptors and adaptor proteins. This interaction relieves autoinhibition of the phosphatase domain, enabling SHP2 to dephosphorylate specific substrates and propagate signaling cascades. SHP2 is a well-established positive regulator of the MAPK signaling pathway and contributes to sustained ERK activation following receptor stimulation. A PTPN11 Antibody enables investigation of phosphatase-dependent signaling mechanisms and SHP2-mediated pathway regulation in research settings.PTPN11 expression is observed across many tissues and cell types, reflecting its involvement in fundamental signaling processes. At the subcellular level, SHP2 is primarily localized to the cytoplasm but is dynamically recruited to activated receptor complexes at the plasma membrane. This regulated localization allows SHP2 to function as a signal-responsive modulator that links receptor activation to intracellular signaling networks. Changes in SHP2 expression or distribution may reflect altered signaling states or cellular responses to external stimuli.At the molecular level, SHP2 consists of tandem SH2 domains, a central protein tyrosine phosphatase domain, and a C-terminal tail containing regulatory phosphorylation sites. These structural features enable precise control of enzymatic activity and protein-protein interactions. Post-translational modifications, including phosphorylation, further regulate SHP2 activity and interactions, contributing to fine-tuning of signaling outputs across different cellular contexts.From a biological and disease relevance perspective, PTPN11 has been extensively studied in developmental biology and disease research. Germline and somatic alterations in PTPN11 are associated with dysregulated signaling and have been implicated in developmental syndromes and cancers. Aberrant SHP2 activity can lead to sustained pathway activation and altered cellular behavior, highlighting its importance as a regulator of signal fidelity and cellular homeostasis.PTPN11 Antibody reagents are valuable tools for studying protein tyrosine phosphatase signaling, receptor-mediated pathway regulation, and intracellular signal integration. These antibodies support research into growth factor signaling, oncogenic pathway activation, and mechanisms governing cellular responsiveness to external cues. NSJ Bioreagents provides PTPN11 Antibody products intended for research use.
| Keywords: | Anti-PTPN11, Anti-SH-PTP3, Anti-SH-PTP2, Anti-Protein-tyrosine phosphatase 1D, Anti-Protein-tyrosine phosphatase 2C, Anti-Tyrosine-protein phosphatase non-receptor type 11, SHP2 Antibody / PTPN11 |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | RQ4920 |
Properties
| Application: | WB, IHC (paraffin), FC, IF |
| Antibody Type: | Monoclonal |
| Clone: | 2000000 |
| Conjugate: | No |
| Host: | Mouse |
| Species reactivity: | human, mouse, rat |
| Immunogen: | Amino acids EKFATLAELVQYYMEHHGQLKEKNGDVIELK from the human protein |
| Format: | Purified |
Database Information
| KEGG ID : | K07293 | Matching products |
| UniProt ID : | Q06124 | Matching products |
| Gene ID : | GeneID 5781 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed