Anti-SET (SET Nuclear Oncogene, Protein SET, 2PP2A, HLA-DR-associated Protein II, Inhibitor of Granz

Anti-SET (SET Nuclear Oncogene, Protein SET, 2PP2A, HLA-DR-associated Protein II, Inhibitor of Granz
Item number Size Datasheet Manual SDS Delivery time Quantity Price
133208.100 100 µg - -

3 - 19 business days*

699.00€
 
Multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone... more
Product information "Anti-SET (SET Nuclear Oncogene, Protein SET, 2PP2A, HLA-DR-associated Protein II, Inhibitor of Granz"
Multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone binding. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1. In the course of cytotoxic T-lymphocyte (CTL)-induced apoptosis, GZMA cleaves SET, disrupting its binding to NME1 and releasing NME1 inhibition. Isoform 1 and isoform 2 are potent inhibitors of protein phosphatase 2A. Isoform 1 and isoform 2 inhibit EP300/CREBBP and PCAF-mediated acetylation of histones (HAT) and nucleosomes, most probably by masking the accessibility of lysines of histones to the acetylases. The predominant target for inhibition is histone H4. HAT inhibition leads to silencing of HAT-dependent transcription and prevents active demethylation of DNA. Both isoforms stimulate DNA replication of the adenovirus genome complexed with viral core proteins, however, isoform 2 specific activity is higher. Applications: Suitable for use in ELISA, Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilutions: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDED, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. ,
Supplier: United States Biological
Supplier-Nr: 133208

Properties

Application: ELISA, IF, WB
Antibody Type: Monoclonal
Clone: M1-F5
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Full length recombinant corresponding to aa1-278 from human SET (AAH32749) with GST tag. MW of the GST tag alone is 26kD.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SET (SET Nuclear Oncogene, Protein SET, 2PP2A, HLA-DR-associated Protein II, Inhibitor of Granz"
Write a review
or to review a product.
Viewed