Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-RQ4301 | 100 µg | - | - |
3 - 10 business days* |
755.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The SCNN1A gene encodes the alpha subunit... more
Product information "Anti-SCNN1A"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The SCNN1A gene encodes the alpha subunit of the epithelial sodium channel (ENaC), a constitutively active channel that allows the flow of sodium ions from the lumen into epithelial cells across the apical cell membrane. The ENaC channel, which is regulated by the renin-angiotensin-aldosterone system, has a central role in the regulation of extracellular fluid volume and blood pressure. The other subunits are encoded by the beta (SCNN1B), gamma (SCNN1G), and delta (SCNN1D) genes. This SCNN1A gene is mapped to 12p13.31. Mutations in this gene have been associated with pseudohypoaldosteronism type 1 (PHA1), a rare salt wasting disease resulting from target organ unresponsiveness to mineralocorticoids. Protein function: Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus. Controls the reabsorption of sodium in kidney, colon, lung and eccrine sweat glands. Also plays a role in taste perception. [The UniProt Consortium]
Keywords: | Anti-SCNN1, Anti-ENaCA, Anti-SCNEA, Anti-SCNN1A, Anti-Alpha-NaCH, Anti-Alpha-ENaC, Anti-Epithelial Na(+) channel subunit alpha, Anti-Nonvoltage-gated sodium channel 1 subunit alpha, Anti-Amiloride-sensitive sodium channel subunit alpha, SCNN1A Antibody |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | RQ4301 |
Properties
Application: | WB, IF |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human |
Immunogen: | amino acids QEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYK |
Format: | Purified |
Database Information
KEGG ID : | K04824 | Matching products |
UniProt ID : | P37088 | Matching products |
Gene ID | GeneID 6337 | Matching products |
Handling & Safety
Storage: | +4°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed