Anti-RIP3

Anti-RIP3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG41273.50 50 µl - -

6 - 14 business days*

584.00€
 
Protein function: Essential for necroptosis, a programmed cell death process in response to... more
Product information "Anti-RIP3"
Protein function: Essential for necroptosis, a programmed cell death process in response to death-inducing TNF-alpha family members. Upon induction of necrosis, RIPK3 interacts with, and phosphorylates RIPK1 and MLKL to form a necrosis-inducing complex. RIPK3 binds to and enhances the activity of three metabolic enzymes: GLUL, GLUD1, and PYGL. These metabolic enzymes may eventually stimulate the tricarboxylic acid cycle and oxidative phosphorylation, which could result in enhanced ROS production. [The UniProt Consortium]
Keywords: Anti-RIP3, Anti-RIP-3, Anti-RIPK3, EC=2.7.11.1, Anti-RIP-like protein kinase 3, Anti-Receptor-interacting protein 3, Anti-Receptor-interacting serine/threonine-protein kinase 3
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG41273

Properties

Application: IP, WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, cow, dog, horse, swine)
Immunogen: Synthetic peptide around the N-terminal region of Human RIP3. (within the following region: GGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAG)
MW: 57 kD
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-RIP3"
Write a review
or to review a product.
Anti-RIPK3 Anti-RIPK3
From 361.00€ *
Anti-RIPK3 Anti-RIPK3
From 361.00€ *
Anti-RIP3 Anti-RIP3
707.00€ *
Anti-RIP3 Anti-RIP3
616.00€ *
Anti-RIP3 Anti-RIP3
658.00€ *
Viewed