Anti-Regucalcin

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59204.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Gluconolactonase with low activity towards other sugar lactones, including... more

Close menu

Product information "Anti-Regucalcin"

Protein function: Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca(2+) signaling, and Ca(2+)-dependent cellular processes and enzyme activities. [The UniProt Consortium]

Keywords:	Anti-RC, Anti-RGN, Anti-GNL, Anti-SMP30, Anti-SMP-30, Anti-Regucalcin, EC=3.1.1.17, Anti-Gluconolactonase, Anti-Senescence marker protein 30
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59204

Properties

Application:	IHC (paraffin)
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	mouse, rat
Immunogen:	Synthetic peptide corresponding to a sequence of Human Regucalcin. (YSVDAFDYDLQTGQISNRRSVYKLEKEEQIPD)
MW:	33 kD
Format:	Antigen Affinity Purified