Anti-Regucalcin

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
NSJ-RQ4348	100 µg		-	-	3 - 10 business days*		790.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Regucalcin is a protein that in humans is... more

Close menu

Product information "Anti-Regucalcin"

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Regucalcin is a protein that in humans is encoded by the RGN gene. The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23. Protein function: Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca(2+) signaling, and Ca(2+)-dependent cellular processes and enzyme activities. [The UniProt Consortium]

Keywords:	Anti-RC, Anti-GNL, Anti-RGN, Anti-SMP30, Anti-SMP-30, Anti-Regucalcin, EC=3.1.1.17, Anti-Gluconolactonase, Anti-Senescence marker protein 30, Regucalcin Antibody
Supplier:	NSJ Bioreagents
Supplier-Nr:	RQ4348

Properties

Application:	WB, IHC (paraffin)
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Amino acids YSVDAFDYDLQTGQISNRRSVYKLEKEEQIPD were used as the immunogen for the Regucalcin antibody.
Format:	Purified