Anti-Properdin

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG40846.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: A positive regulator of the alternate pathway of complement. It binds to and... more

Close menu

Product information "Anti-Properdin"

Protein function: A positive regulator of the alternate pathway of complement. It binds to and stabilizes the C3- and C5-convertase enzyme complexes. [The UniProt Consortium]

Keywords:	Anti-PFC, Anti-CFP, Anti-Properdin, Anti-Complement factor P
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG40846

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to a sequence of Human Properdin. (MVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKR)
MW:	51 kD
Format:	Antigen Affinity Purified