Anti-CFP / Properdin

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4672 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Properdin (factor P) is a plasma protein... more
Product information "Anti-CFP / Properdin"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Properdin (factor P) is a plasma protein that is active in the alternative complement pathway of the innate immune system. It is mapped to Xp11.23. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedback loop that ultimately leads to formation of the membrane attack complex and lysis of the target cell. Mutations in this gene result in two forms of properdin deficiency, which results in high susceptibility to meningococcal infections. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Keywords: Anti-CFP, Anti-PFC, Anti-Properdin, Anti-Complement factor P, CFP Antibody / Properdin
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4672

Properties

Application: WB, IHC (paraffin), FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids MVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKR
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CFP / Properdin"
Write a review
or to review a product.
Viewed