Anti-Peroxiredoxin 4 / PRDX4

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32208 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PRDX4 (Peroxiredoxin 4) is also known as... more
Product information "Anti-Peroxiredoxin 4 / PRDX4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PRDX4 (Peroxiredoxin 4) is also known as AOE37-2. The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. Functional analysis showed that PRDX4 protects glutamine synthetase from inactivation. Yeast 2-hybrid, immunoprecipitation, and immunoblot analyses indicated that PRDX4 and PRDX1 are capable of homodimerization and heterodimerization with each other but not with the mitochondrial PRDX3. Gel mobility shift and immunoblot analysis found that PRDX4 depletes NFKB binding activity together with a reduction in the amounts of p50, p65, and phosphorylated IKBA, as well as a reduction in the expression of HIV-1 viral proteins. Expression of PRDX4, alone or with PRDX1, increased the resistance of yeast cells to oxidant-induced toxicity. Jin et al. suggested PRDX4 modulates IKBA phosphorylation in the cytoplasm and thus affects a peroxiredoxin-dependent redox step. Protein function: Probably involved in redox regulation of the cell. Regulates the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation. [The UniProt Consortium]
Keywords: Anti-PRDX4, Anti-Prx-IV, Anti-AOE37-2, EC=1.11.1.15, Anti-Peroxiredoxin-4, Anti-Peroxiredoxin IV, Anti-Antioxidant enzyme AOE372, Anti-Thioredoxin peroxidase AO372, Anti-Thioredoxin-dependent peroxide reductase A0372, Peroxiredoxin 4 Antibody / PRDX4
Supplier: NSJ Bioreagents
Supplier-Nr: R32208

Properties

Application: WB, IHC (paraffin), ICC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK of human Peroxiredoxin 4 were used as the immunogen for the Peroxiredoxin 4 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Peroxiredoxin 4 / PRDX4"
Write a review
or to review a product.
Viewed