Anti-PDK4

Anti-PDK4
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40708.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Kinase that plays a key role in regulation of glucose and fatty acid metabolism... more
Product information "Anti-PDK4"
Protein function: Kinase that plays a key role in regulation of glucose and fatty acid metabolism and homeostasis via phosphorylation of the pyruvate dehydrogenase subunits PDHA1 and PDHA2. This inhibits pyruvate dehydrogenase activity, and thereby regulates metabolite flux through the tricarboxylic acid cycle, down-regulates aerobic respiration and inhibits the formation of acetyl-coenzyme A from pyruvate. Inhibition of pyruvate dehydrogenase decreases glucose utilization and increases fat metabolism in response to prolonged fasting and starvation. Plays an important role in maintaining normal blood glucose levels under starvation, and is involved in the insulin signaling cascade. Via its regulation of pyruvate dehydrogenase activity, plays an important role in maintaining normal blood pH and in preventing the accumulation of ketone bodies under starvation. In the fed state, mediates cellular responses to glucose levels and to a high-fat diet. Regulates both fatty acid oxidation and de novo fatty acid biosynthesis. Plays a role in the generation of reactive oxygen species. Protects detached epithelial cells against anoikis. Plays a role in cell proliferation via its role in regulating carbohydrate and fatty acid metabolism. [The UniProt Consortium]
Keywords: Anti-PDK4, Anti-PDHK4, EC=2.7.11.2, Anti-Pyruvate dehydrogenase kinase isoform 4, Anti-[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40708

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 91-125 of Human PDK4. (WYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRN)
MW: 46 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PDK4"
Write a review
or to review a product.
Viewed