Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used

Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
131045-APC.100 | 100 µl | - | - |
3 - 19 business days* |
948.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Cyclic nucleotide phosphodiesterases (PDEs) catalyze hydrolysis of the cyclic nucleotides cAMP... more
Product information "Anti-PDE1B (PDE1B1, PDES1B, Calcium/Calmodulin-dependent 3',5'-cyclic Nucleotide Phosphodiesterase 1"
Cyclic nucleotide phosphodiesterases (PDEs) catalyze hydrolysis of the cyclic nucleotides cAMP and cGMP to the corresponding nucleoside 5-prime-monophosphates. Mammalian PDEs have been classified into several families based on their biochemical properties. Members of the PDE1 family, such as PDE1B, are calmodulin (see MIM 114180)-dependent PDEs (CaM-PDEs) that are stimulated by a calcium-calmodulin complex (Repaske et al., 1992 [PubMed 1326532]). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD, Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap., , Note: Applications are based on unconjugated antibody.
Keywords: | Anti-PDE1B, Anti-PDE1B1, Anti-Cam-PDE 1B, EC=3.1.4.17, Anti-63 kDa Cam-PDE, Anti-Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B |
Supplier: | United States Biological |
Supplier-Nr: | 131045-APC |
Properties
Application: | ELISA, WB |
Antibody Type: | Monoclonal |
Clone: | 5B6 |
Conjugate: | No |
Host: | Mouse |
Species reactivity: | human |
Immunogen: | Partial recombinant corresponding to aa437-536 from human PDE1B (AAH32226) with GST tag. MW of the GST tag alone is 26kD |
Format: | Affinity Purified |
Database Information
KEGG ID : | K13755 | Matching products |
UniProt ID : | Q01064 | Matching products |
Gene ID : | GeneID 5153 | Matching products |
Handling & Safety
Storage: | +4°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed