Anti-PDE1B (PDE1B1, PDES1B, Calcium/Calmodulin-dependent 3',5'-cyclic Nucleotide Phosphodiesterase 1

Anti-PDE1B (PDE1B1, PDES1B, Calcium/Calmodulin-dependent 3',5'-cyclic Nucleotide Phosphodiesterase 1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
131045-APC.100 100 µl - -

3 - 19 business days*

948.00€
 
Cyclic nucleotide phosphodiesterases (PDEs) catalyze hydrolysis of the cyclic nucleotides cAMP... more
Product information "Anti-PDE1B (PDE1B1, PDES1B, Calcium/Calmodulin-dependent 3',5'-cyclic Nucleotide Phosphodiesterase 1"
Cyclic nucleotide phosphodiesterases (PDEs) catalyze hydrolysis of the cyclic nucleotides cAMP and cGMP to the corresponding nucleoside 5-prime-monophosphates. Mammalian PDEs have been classified into several families based on their biochemical properties. Members of the PDE1 family, such as PDE1B, are calmodulin (see MIM 114180)-dependent PDEs (CaM-PDEs) that are stimulated by a calcium-calmodulin complex (Repaske et al., 1992 [PubMed 1326532]). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD, Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap., , Note: Applications are based on unconjugated antibody.
Keywords: Anti-PDE1B, Anti-PDE1B1, Anti-Cam-PDE 1B, EC=3.1.4.17, Anti-63 kDa Cam-PDE, Anti-Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B
Supplier: United States Biological
Supplier-Nr: 131045-APC

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 5B6
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Partial recombinant corresponding to aa437-536 from human PDE1B (AAH32226) with GST tag. MW of the GST tag alone is 26kD
Format: Affinity Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PDE1B (PDE1B1, PDES1B, Calcium/Calmodulin-dependent 3',5'-cyclic Nucleotide Phosphodiesterase 1"
Write a review
or to review a product.
Viewed