Anti-PAR1 / F2R / Thrombin Receptor

Anti-PAR1 / F2R / Thrombin Receptor
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32032 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Proteinase-activated receptor 1 (PAR-1),... more
Product information "Anti-PAR1 / F2R / Thrombin Receptor"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Proteinase-activated receptor 1 (PAR-1), also known as the coagulation factor II (thrombin) receptor, is a protein that in humans is encoded by the F2R gene. By fluorescence in situ hybridization, this gene is mapped to 5q13, confirming its presence as a single locus in the human genome. PAR1 is a G protein-coupled receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. The expression of PAR1 is both required and sufficient to promote growth and invasion of breast carcinoma cells in a xenograft mouse model. Protein function: High affinity receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis. May play a role in platelets activation and in vascular development. [The UniProt Consortium]
Keywords: Anti-F2R, Anti-CF2R, Anti-PAR-1, Anti-Thrombin receptor, Anti-Coagulation factor II receptor, Anti-Proteinase-activated receptor 1, PAR1 Antibody / F2R / Thrombin Receptor
Supplier: NSJ Bioreagents
Supplier-Nr: R32032

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids RNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQK of human PAR-1/Thrombin Receptor were used as the immunogen for the Thrombin Receptor antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PAR1 / F2R / Thrombin Receptor"
Write a review
or to review a product.
Viewed