Anti-NSE / Neuron Specific Enolase

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4566 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. NSE (neuron specific enolase), also known... more
Product information "Anti-NSE / Neuron Specific Enolase"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. NSE (neuron specific enolase), also known as Enolase 2 (ENO2), is found in elevated concentrations in plasma in certain neoplasias. The enolases catalyze the interconversion of 2-phosphoglycerate to phosphoenolpyruvate in the glycolytic pathway. ENO2 gene contains 12 exons distributed over 9,213 nucleotides. Human neurone-specific enolase is mapped to chromosome 12p13. Protein function: Has neurotrophic and neuroprotective properties on a broad spectrum of central nervous system (CNS) neurons. Binds, in a calcium-dependent manner, to cultured neocortical neurons and promotes cell survival. [The UniProt Consortium]
Keywords: Anti-NSE, Anti-ENO2, Anti-Enolase 2, EC=4.2.1.11, Anti-Gamma-enolase, Anti-Neural enolase, Anti-Neuron-specific enolase, Anti-2-phospho-D-glycerate hydro-lyase, NSE Antibody / Neuron Specific Enolase
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4566

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids LKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENK
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-NSE / Neuron Specific Enolase"
Write a review
or to review a product.
Viewed