Anti-NKCC2 / SLC12A1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32222 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Solute carrier family 12... more
Product information "Anti-NKCC2 / SLC12A1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Solute carrier family 12 (sodium/potassium/chloride transporters), member 1, also called NKCC2 is specifically found in cells of the thick ascending limb of the loop of Henle in nephrons, the basic functional units of the kidney. This gene is mapped to 15q21.1. This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa. It plays a key role in concentrating urine and accounts for most of the NaCl resorption. It is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. This gene plays a vital role in the regulation of ionic balance and cell volume. Protein function: Renal sodium, potassium and chloride ion cotransporter that mediates the transepithelial NaCl reabsorption in the thick ascending limb and plays an essential role in the urinary concentration and volume regulation (PubMed:21321328). Electrically silent transporter system. [The UniProt Consortium]
Keywords: Anti-SLC12A1, Anti-Solute carrier family 12 member 1, Anti-Kidney-specific Na-K-Cl symporter, Anti-Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2, NKCC2 Antibody / SLC12A1
Supplier: NSJ Bioreagents
Supplier-Nr: R32222

Properties

Application: WB, IHC (paraffin), IF
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat, monkey
Immunogen: Amino acids DEAQKRLRISFRPGNQECYDNFLQSGETAKTD of human SLC12A1
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-NKCC2 / SLC12A1"
Write a review
or to review a product.
Viewed