Anti-MUNC18-1 / STXBP1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32158 100 µg - -

7 - 12 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Syntaxin-binding protein 1, also known as... more
Product information "Anti-MUNC18-1 / STXBP1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Syntaxin-binding protein 1, also known as Munc18-1, is a protein that in humans is encoded by the STXBP1 gene. By fluorescence in situ hybridization, the STXBP1 gene is mapped to chromosome 9q34.1. This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described. Protein function: Participates in the regulation of synaptic vesicle docking and fusion through interaction with GTP-binding proteins. Essential for neurotransmission and binds syntaxin, a component of the synaptic vesicle fusion machinery probably in a 1:1 ratio. Can interact with syntaxins 1, 2, and 3 but not syntaxin 4. May play a role in determining the specificity of intracellular fusion reactions. [The UniProt Consortium]
Keywords: Anti-p67, Anti-STXBP1, Anti-UNC18A, Anti-N-Sec1, Anti-Unc18-1, Anti-Unc-18A, Anti-MUNC18-1, Anti-Protein unc-18 homolog 1, Anti-Protein unc-18 homolog A, Anti-Syntaxin-binding protein 1, MUNC18-1 Antibody / STXBP1
Supplier: NSJ Bioreagents
Supplier-Nr: R32158

Properties

Application: WB, IHC (paraffin), IF, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD of human MUNC18-1
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MUNC18-1 / STXBP1"
Write a review
or to review a product.
Viewed