Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used

Anti-MPP1

Arigo
Anti-MPP1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59030.50 50 µg - -

6 - 14 business days*

551.00€
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
 
Description Product Citations Certificate of Analysis Reviews 0
Description
Protein function: Essential regulator of neutrophil polarity. Regulates neutrophil polarization... more
Close menu
Product information "Anti-MPP1"
Protein function: Essential regulator of neutrophil polarity. Regulates neutrophil polarization by regulating AKT1 phosphorylation through a mechanism that is independent of PIK3CG activity. [The UniProt Consortium]
Keywords: Anti-p55, Anti-MPP1, Anti-DXS552E, Anti-Membrane protein, palmitoylated 1, Anti-55 kDa erythrocyte membrane protein
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59030

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat (Expected: hamster)
Immunogen: Synthetic peptide corresponding to aa. 409-450 of Human MPP1 (TEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAF)
MW: 52 kD
Format: Antigen Affinity Purified

Database Information

KEGG ID : K21880 | Matching products
UniProt ID : Q00013 | Matching products
Gene ID : GeneID 4354 | Matching products

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
Product Citations
Information about the product reference will follow. more
Close menu
Certificate of Analysis
You will get a certificate here
Go back
or to request a certificate of analysis.
Reviews 0
Read, write and discuss reviews... more
Close menu
Customer review for "Anti-MPP1"
Write a review
or to review a product.
Similar products
Similar products
Anti-MPP1, ID (MPP1, DXS552E, EMP55, 55kD erythrocyte membrane protein, Membrane protein, palmitoyla Anti-MPP1, ID (MPP1, DXS552E, EMP55, 55kD erythrocyte...
767.00€ *
Anti-MPP1/P55 Anti-MPP1/P55
From 178.00€ *
Anti-MPP1 Anti-MPP1
772.00€ *
Anti-MPP1 Anti-MPP1
616.00€ *
Viewed
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the usability of this website, serve for direct advertising or simplify interaction with other websites and social networks, will only be used with your consent. More information
Decline Accept all Configure