Anti-MPP1

Anti-MPP1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32546 100 µg - -

7 - 12 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Membrane Palmitoylated Protein 1, also... more
Product information "Anti-MPP1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Membrane Palmitoylated Protein 1, also called '55 kDa erythrocyte membrane protein,' is a protein that in humans is encoded by the MPP1 gene. This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene. Protein function: Essential regulator of neutrophil polarity. Regulates neutrophil polarization by regulating AKT1 phosphorylation through a mechanism that is independent of PIK3CG activity. [The UniProt Consortium]
Keywords: Anti-p55, Anti-MPP1, Anti-DXS552E, Anti-Membrane protein, palmitoylated 1, Anti-55 kDa erythrocyte membrane protein, MPP1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32546

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids 409-450 (TEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAF) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MPP1"
Write a review
or to review a product.
Viewed