Anti-MEK3 / MAP2K3 / MKK3

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32106 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Dual specificity mitogen-activated protein... more
Product information "Anti-MEK3 / MAP2K3 / MKK3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Dual specificity mitogen-activated protein kinase kinase 3 is an enzyme that in humans is encoded by the MAP2K3 gene. The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. And this kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. Rampoldi et al. (1997) localized the MAP2K3 gene to 17q11.2. Protein function: Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38. Part of a signaling cascade that begins with the activation of the adrenergic receptor ADRA1B and leads to the activation of MAPK14. [The UniProt Consortium]
Keywords: Anti-MEK3, Anti-MEK 3, Anti-SAPKK2, Anti-MAP2K3, Anti-SAPKK-2, Anti-MAPKK 3, Anti-SAPK kinase 2, Anti-MAPK/ERK kinase 3, Anti-MAP kinase kinase 3, Anti-Stress-activated protein kinase kinase 2, MEK3 Antibody / MAP2K3 / MKK3
Supplier: NSJ Bioreagents
Supplier-Nr: R32106

Properties

Application: WB, IHC (paraffin), IF, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS of human MAP2K3/MEK3
Format: Phosphorylation (other)

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MEK3 / MAP2K3 / MKK3"
Write a review
or to review a product.
Viewed