Anti-MDR1 / P Glycoprotein 1

Anti-MDR1 / P Glycoprotein 1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40826.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Energy-dependent efflux pump responsible for decreased drug accumulation in... more
Product information "Anti-MDR1 / P Glycoprotein 1"
Protein function: Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells. [The UniProt Consortium]
Keywords: Anti-MDR1, Anti-ABCB1, Anti-CD243, EC=7.6.2.2, Anti-P-glycoprotein 1, Anti-Multidrug resistance protein 1, Anti-ATP-binding cassette sub-family B member 1
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40826

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat)
Immunogen: Synthetic peptide corresponding to a sequence of Human P Glycoprotein 1. (QAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPY)
MW: 141 kD

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MDR1 / P Glycoprotein 1"
Write a review
or to review a product.
Viewed