Anti-MC3R / MC3 Receptor

Anti-MC3R / MC3 Receptor
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32721 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Melanocortin receptor 3 is a protein that... more
Product information "Anti-MC3R / MC3 Receptor"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Melanocortin receptor 3 is a protein that in humans is encoded by the MC3R gene. It is mapped to 20q13.2. This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans. Protein function: Receptor for MSH (alpha, beta and gamma) and ACTH. This receptor is mediated by G proteins which activate adenylate cyclase. Required for expression of anticipatory patterns of activity and wakefulness during periods of limited nutrient availability and for the normal regulation of circadian clock activity in the brain. [The UniProt Consortium]
Keywords: Anti-MC3R, Anti-MC3-R, Anti-Melanocortin receptor 3, MC3R Antibody / MC3 Receptor
Supplier: NSJ Bioreagents
Supplier-Nr: R32721

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse
Immunogen: Amino acids 91-121 (NALETIMIAIVHSDYLTFEDQFIQHMDNIFD) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MC3R / MC3 Receptor"
Write a review
or to review a product.
Viewed