Anti-MAOA

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40378.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has... more
Product information "Anti-MAOA"
Protein function: Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine. [The UniProt Consortium]
Keywords: Anti-MAOA, Anti-MAO-A, EC=1.4.3.4, Anti-Monoamine oxidase type A, Anti-Amine oxidase [flavin-containing] A
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40378

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 457-493 of Human MAOA. (REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER)
MW: 59 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-MAOA"
Write a review
or to review a product.
Viewed