Anti-Lysozyme

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40281.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Lysozymes have primarily a bacteriolytic function, those in tissues and body... more
Product information "Anti-Lysozyme"
Protein function: Lysozymes have primarily a bacteriolytic function, those in tissues and body fluids are associated with the monocyte- macrophage system and enhance the activity of immunoagents. [The UniProt Consortium]
Keywords: Anti-LYZ, Anti-LZM, Anti-Lysozyme C, EC=3.2.1.17, Anti-1,4-beta-N-acetylmuramidase C
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40281

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Synthetic peptide corresponding to aa. 106-141 of Human Lysozyme. (NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ)
MW: 16.5 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Lysozyme"
Write a review
or to review a product.
Viewed