Anti-LRIG3

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59893.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: May play a role in craniofacial and inner ear morphogenesis during embryonic... more

Close menu

Product information "Anti-LRIG3"

Protein function: May play a role in craniofacial and inner ear morphogenesis during embryonic development. May act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1. [The UniProt Consortium]

Keywords:	Anti-LIG3, Anti-LRIG3, Anti-LIG-3, Anti-Leucine-rich repeats and immunoglobulin-like domains protein 3
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59893

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, rat (Expected: bovine, horse, monkey, rabbit)
Immunogen:	Synthetic peptide corresponding to aa. 428-465 of Human LRIG3. (NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ)
MW:	123 kD
Format:	Antigen Affinity Purified