Anti-LRIG3

Anti-LRIG3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32545 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. LRIG3 (leucine-rich repeats and Ig-like... more
Product information "Anti-LRIG3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. LRIG3 (leucine-rich repeats and Ig-like domains-3) is a 140 kDa type I transmembrane glycoprotein member of the mammalian LRIG glycoprotein family. It shares 46.8% and 54.0% amino acid identity with LRIG1 and LRIG2, respectively, with highest conservation in the extracellular, transmembrane, and membrane-proximal sequences. This gene is mapped to chromosome 12q13.2. LRIG3 may play a role in craniofacial and inner ear morphogenesis during embryonic development. It also may act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1. Protein function: May play a role in craniofacial and inner ear morphogenesis during embryonic development. May act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1. [The UniProt Consortium]
Keywords: Anti-LIG3, Anti-LRIG3, Anti-LIG-3, Anti-Leucine-rich repeats and immunoglobulin-like domains protein 3, LRIG3 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32545

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Amino acids 428-465 (NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-LRIG3"
Write a review
or to review a product.
Viewed