Anti-LRIG3

Anti-LRIG3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59893.50 50 µg - -

10 - 15 business days*

551.00€
 
Protein function: May play a role in craniofacial and inner ear morphogenesis during embryonic... more
Product information "Anti-LRIG3"
Protein function: May play a role in craniofacial and inner ear morphogenesis during embryonic development. May act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1. [The UniProt Consortium]
Keywords: Anti-LIG3, Anti-LRIG3, Anti-LIG-3, Anti-Leucine-rich repeats and immunoglobulin-like domains protein 3
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59893

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat (Expected: bovine, horse, monkey, rabbit)
Immunogen: Synthetic peptide corresponding to aa. 428-465 of Human LRIG3. (NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ)
MW: 123 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-LRIG3"
Write a review
or to review a product.
Viewed