Anti-LPAR6 / P2RY5

Anti-LPAR6 / P2RY5
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59203.50 50 µg - -

10 - 15 business days*

551.00€
 
Protein function: Binds to oleoyl-L-alpha-lysophosphatidic acid (LPA). Intracellular cAMP is... more
Product information "Anti-LPAR6 / P2RY5"
Protein function: Binds to oleoyl-L-alpha-lysophosphatidic acid (LPA). Intracellular cAMP is involved in the receptor activation. Important for the maintenance of hair growth and texture. [The UniProt Consortium]
Keywords: Anti-P2Y5, Anti-P2RY5, Anti-LPAR6, Anti-LPA-6, Anti-LPA receptor 6, Anti-P2Y purinoceptor 5, Anti-Purinergic receptor 5, Anti-Lysophosphatidic acid receptor 6, Anti-RB intron encoded G-protein coupled receptor
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59203

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat)
Immunogen: Synthetic peptide corresponding to a sequence of Human LPAR6 / P2RY5. (DTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLK)
MW: 39 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-LPAR6 / P2RY5"
Write a review
or to review a product.
Viewed