Anti-P2RY5 / P2Y Purinoceptor 5 / LPAR6

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4219 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Lysophosphatidic acid receptor 6 also... more
Product information "Anti-P2RY5 / P2Y Purinoceptor 5 / LPAR6"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Lysophosphatidic acid receptor 6 also known as LPA6, P2RY5, and GPR87, is a protein that in humans is encoded by the LPAR6 gene. The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. This gene aligns with an internal intron of the retinoblastoma susceptibility gene in the reverse orientation. Alternative splicing results in multiple transcript variants. Protein function: Binds to oleoyl-L-alpha-lysophosphatidic acid (LPA). Intracellular cAMP is involved in the receptor activation. Important for the maintenance of hair growth and texture. [The UniProt Consortium]
Keywords: Anti-P2Y5, Anti-LPAR6, Anti-P2RY5, Anti-LPA-6, Anti-LPA receptor 6, Anti-P2Y purinoceptor 5, Anti-Purinergic receptor 5, Anti-Lysophosphatidic acid receptor 6, Anti-RB intron encoded G-protein coupled receptor, P2RY5 Antibody / P2Y Purinoceptor 5 / LPAR6
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4219

Properties

Application: WB, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: amino acids DTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLK
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-P2RY5 / P2Y Purinoceptor 5 / LPAR6"
Write a review
or to review a product.
Viewed