Anti-LPAR6 / P2RY5

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59203.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Binds to oleoyl-L-alpha-lysophosphatidic acid (LPA). Intracellular cAMP is... more

Close menu

Product information "Anti-LPAR6 / P2RY5"

Protein function: Binds to oleoyl-L-alpha-lysophosphatidic acid (LPA). Intracellular cAMP is involved in the receptor activation. Important for the maintenance of hair growth and texture. [The UniProt Consortium]

Keywords:	Anti-P2Y5, Anti-P2RY5, Anti-LPAR6, Anti-LPA-6, Anti-LPA receptor 6, Anti-P2Y purinoceptor 5, Anti-Purinergic receptor 5, Anti-Lysophosphatidic acid receptor 6, Anti-RB intron encoded G-protein coupled receptor
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59203

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat)
Immunogen:	Synthetic peptide corresponding to a sequence of Human LPAR6 / P2RY5. (DTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLK)
MW:	39 kD
Format:	Antigen Affinity Purified