Anti-KIM-1 / TIM-1 / HAVCR1

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
NSJ-R32305	100 µg		-	-	3 - 10 business days*		755.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Kidney injury molecule 1, also known as... more

Close menu

Product information "Anti-KIM-1 / TIM-1 / HAVCR1"

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Kidney injury molecule 1, also known as HAVCR1, HAVCR or TIM1, is a protein that in humans is encoded by the HAVCR1 gene. It may play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4 (By similarity). May play a role in kidney injury and repair. [UniProt] Protein function: May play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4. May play a role in kidney injury and repair. [The UniProt Consortium]

Keywords:	Anti-TIM, Anti-KIM1, Anti-KIM-1, Anti-TIM-1, Anti-TIMD-1, Anti-HAVCR1, Anti-HAVcr-1, Anti-Kidney injury molecule 1, Anti-T-cell membrane protein 1, Anti-Hepatitis A virus cellular receptor 1, Anti-T-cell immunoglobulin mucin receptor 1, KIM-1 Antibody / T
Supplier:	NSJ Bioreagents
Supplier-Nr:	R32305

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human
Immunogen:	Amino acids QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD of human HAVCR1 were used as the immunogen for the KIM1 antibody.
Format:	Purified