Anti-KIM-1 / TIM-1 / HAVCR1

Anti-KIM-1 / TIM-1 / HAVCR1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32305 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Kidney injury molecule 1, also known as... more
Product information "Anti-KIM-1 / TIM-1 / HAVCR1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Kidney injury molecule 1, also known as HAVCR1, HAVCR or TIM1, is a protein that in humans is encoded by the HAVCR1 gene. It may play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4 (By similarity). May play a role in kidney injury and repair. [UniProt] Protein function: May play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4. May play a role in kidney injury and repair. [The UniProt Consortium]
Keywords: Anti-TIM, Anti-KIM1, Anti-KIM-1, Anti-TIM-1, Anti-TIMD-1, Anti-HAVCR1, Anti-HAVcr-1, Anti-Kidney injury molecule 1, Anti-T-cell membrane protein 1, Anti-Hepatitis A virus cellular receptor 1, Anti-T-cell immunoglobulin mucin receptor 1, KIM-1 Antibody / T
Supplier: NSJ Bioreagents
Supplier-Nr: R32305

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD of human HAVCR1 were used as the immunogen for the KIM1 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-KIM-1 / TIM-1 / HAVCR1"
Write a review
or to review a product.
Viewed