Anti-KDM5B / Jarid1B

Anti-KDM5B / Jarid1B
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32541 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Lysine-specific demethylase 5B, also known... more
Product information "Anti-KDM5B / Jarid1B"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Lysine-specific demethylase 5B, also known as histone demethylase JARID1B, is a demethylase enzyme that in humans is encoded by the KDM5B gene. This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing resultsi n multiple transcript variants. Protein function: Histone demethylase that demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code (PubMed:24952722, PubMed:27214403, PubMed:28262558). Does not demethylate histone H3 'Lys-9' or H3 'Lys-27'. Demethylates trimethylated, dimethylated and monomethylated H3 'Lys-4'. Acts as a transcriptional corepressor for FOXG1B and PAX9. Favors the proliferation of breast cancer cells by repressing tumor suppressor genes such as BRCA1 and HOXA5 (PubMed:24952722). In contrast, may act as a tumor suppressor for melanoma. Represses the CLOCK-BMAL1 heterodimer-mediated transcriptional activation of the core clock component PER2. [The UniProt Consortium]
Keywords: Anti-CT31, Anti-KDM5B, Anti-PLU-1, Anti-JARID1B, Anti-RBP2-H1, Anti-Cancer/testis antigen 31, Anti-Histone demethylase JARID1B, Anti-Lysine-specific demethylase 5B, Anti-Jumonji/ARID domain-containing protein 1B, KDM5B Antibody / Jarid1B
Supplier: NSJ Bioreagents
Supplier-Nr: R32541

Properties

Application: WB, IHC (paraffin), IF, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat, monkey
Immunogen: Amino acids 641-685 (DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELL) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-KDM5B / Jarid1B"
Write a review
or to review a product.
Viewed