Anti-JUND

Anti-JUND
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4433 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Transcription factor JunD is a protein... more
Product information "Anti-JUND"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Transcription factor JunD is a protein that in humans is encoded by the JUND gene. The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative translation initiation site usage results in the production of different isoforms. Protein function: Transcription factor binding AP-1 sites (PubMed:9989505). Heterodimerizes with proteins of the FOS family to form an AP-1 transcription factor complex, thereby enhancing their DNA binding activity to an AP-1 consensus sequence 3'-TGA[GC]TCA-5' and enhancing their transcriptional activity (PubMed:28981703, PubMed:9989505). [The UniProt Consortium]
Keywords: Anti-JUND, Anti-Transcription factor JunD, Anti-Transcription factor AP-1 subunit JunD, JUND Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4433

Properties

Application: WB, IHC (paraffin), FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids TASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-JUND"
Write a review
or to review a product.
Viewed