Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-R32105 | 100 µg | - | - |
3 - 10 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. JNK2 antibody targets c-Jun N-terminal... more
Product information "Anti-JNK2 / c-Jun N-terminal kinase 2 / MAPK9"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. JNK2 antibody targets c-Jun N-terminal kinase 2, encoded by the MAPK9 gene. c-Jun N-terminal kinase 2 is a serine-threonine protein kinase that belongs to the mitogen-activated protein kinase (MAPK) family, which transduces extracellular stress signals into intracellular responses. JNK family members are activated by environmental stress, inflammatory cytokines, and growth factor signaling, playing central roles in cellular adaptation and survival.Functionally, c-Jun N-terminal kinase 2 participates in phosphorylation of transcription factors such as c-Jun and other AP-1 family members, thereby regulating gene expression programs linked to apoptosis, proliferation, and immune responses. JNK2 activity contributes to stress-activated signaling cascades that influence both acute signaling outcomes and longer-term transcriptional regulation. A JNK2 antibody supports studies focused on MAPK pathway dynamics, stress signaling, and transcriptional control mechanisms downstream of kinase activation.JNK2 is expressed across a wide range of tissues and cell types, with prominent roles in immune cells, epithelial cells, and neuronal systems. Subcellular localization is primarily cytoplasmic under basal conditions, with translocation to the nucleus following activation to regulate transcription factor targets. Localization and activation status can vary depending on stimulus type, duration, and cellular context, reflecting the kinase's role as a signaling integrator rather than a constitutively active enzyme.From a disease relevance perspective, dysregulation of c-Jun N-terminal kinase 2 signaling has been investigated in inflammatory disorders, neurodegenerative disease, and cancer, where altered stress response pathways can influence cell fate decisions. Structurally, JNK2 contains a conserved MAP kinase domain responsible for substrate recognition and catalytic activity, along with regulatory regions that govern activation and interaction with scaffold proteins. JNK2 antibody reagents support research applications examining stress-activated signaling pathways, with NSJ Bioreagents providing tools intended for research use.
| Keywords: | Anti-MAPK9, Anti-JNK-55, Anti-c-Jun N-terminal kinase 2, Anti-Mitogen-activated protein kinase 9, Anti-Stress-activated protein kinase 1a, Anti-Stress-activated protein kinase JNK2, JNK2 Antibody / c-Jun N-terminal kinase 2 / MAPK9 |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | R32105 |
Properties
| Application: | WB, IF, FC |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
| Immunogen: | Amino acids RNYVENRPKYPGIKFEELFPDWIFPSESERDK of human JNK2a/b |
| Format: | Purified |
Database Information
| KEGG ID : | K04440 | Matching products |
| UniProt ID : | P45984 | Matching products |
| Gene ID : | GeneID 5601 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed