Anti-IL6R (Interleukin-6 Receptor Subunit alpha, IL-6 Receptor Subunit alpha, IL-6R Subunit alpha, I

Anti-IL6R (Interleukin-6 Receptor Subunit alpha, IL-6 Receptor Subunit alpha, IL-6R Subunit alpha, I
Item number Size Datasheet Manual SDS Delivery time Quantity Price
128475.100 100 µg - -

3 - 19 business days*

744.00€
 
IL6R is a transmembrane protein that associates with the signal-transducing subunit gp130 to form... more
Product information "Anti-IL6R (Interleukin-6 Receptor Subunit alpha, IL-6 Receptor Subunit alpha, IL-6R Subunit alpha, I"
IL6R is a transmembrane protein that associates with the signal-transducing subunit gp130 to form a high-affinity receptor complex for IL-6. It is expressed on T cells, activated B cells, and peripheral monocytes. A soluble form of IL6R can be released by proteolytic cleavage. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 128475

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Full length human IL6R, aa1-468 (NP_000556.1).
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-IL6R (Interleukin-6 Receptor Subunit alpha, IL-6 Receptor Subunit alpha, IL-6R Subunit alpha, I"
Write a review
or to review a product.
Viewed