Anti-IL6R (C-Terminal Region)

Anti-IL6R (C-Terminal Region)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32900 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Interleukin 6 receptor (IL6R), also known... more
Product information "Anti-IL6R (C-Terminal Region)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Interleukin 6 receptor (IL6R), also known as CD126 (Cluster of Differentiation 126), is a type I cytokine receptor. This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. A pseudogene of this gene is found on chromosome 9. Protein function: Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis. [The UniProt Consortium]
Keywords: Anti-IL6R, Anti-gp80, Anti-CD126, Anti-IL-6RA, Anti-IL-6R 1, Anti-IL-6R-alpha, Anti-IL-6R subunit alpha, Anti-Membrane glycoprotein 80, Anti-IL-6 receptor subunit alpha, Anti-Interleukin-6 receptor subunit alpha, IL6R Antibody (C-Terminal Region)
Supplier: NSJ Bioreagents
Supplier-Nr: R32900

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids 379-419 (LLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPR) were used as the immunogen for the IL6R antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-IL6R (C-Terminal Region)"
Write a review
or to review a product.
Viewed