Anti-IGFBP3

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG10675.50	50 µg		-	-	6 - 14 business days*		559.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: IGF-binding proteins prolong the half-life of the IGFs and have been shown to... more

Close menu

Product information "Anti-IGFBP3"

Protein function: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Also exhibits IGF-independent antiproliferative and apoptotic effects mediated by its receptor TMEM219/IGFBP-3R. [The UniProt Consortium]

Keywords:	Anti-IBP3, Anti-IBP-3, Anti-IGFBP3, Anti-IGFBP-3, Anti-IGF-binding protein 3, Anti-Insulin-like growth factor-binding protein 3
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG10675

Properties

Application:	WB, IHC (paraffin)
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, rat
Immunogen:	Synthetic peptide corresponding to the sequence at a.a 214-252 (RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR) around the C-terminus of human IGFBP3 protein
Format:	Antigen Affinity Purified