Anti-IGFBP3

Anti-IGFBP3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31990 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. IGFBP3, Insulin-like growth fator-binding... more
Product information "Anti-IGFBP3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. IGFBP3, Insulin-like growth fator-binding protein 3, is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. IGFBP3 is located on chromosome 7. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. Protein function: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Also exhibits IGF-independent antiproliferative and apoptotic effects mediated by its receptor TMEM219/IGFBP-3R. [The UniProt Consortium]
Keywords: Anti-IBP3, Anti-IBP-3, Anti-IGFBP3, Anti-IGFBP-3, Anti-IGF-binding protein 3, Anti-Insulin-like growth factor-binding protein 3, IGFBP3 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R31990

Properties

Application: WB, IHC (paraffin), ELISA
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Amino acids RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR of human IGFBP3 were used as the immunogen for the IGFBP3 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-IGFBP3"
Write a review
or to review a product.
Viewed