Anti-Hypoxia Inducible Factor 2a (Hypoxia Inducible Factor 2 alpha, Hypoxia-inducible Factor 2-alpha

Anti-Hypoxia Inducible Factor 2a (Hypoxia Inducible Factor 2 alpha, Hypoxia-inducible Factor 2-alpha
Item number Size Datasheet Manual SDS Delivery time Quantity Price
H9810-01R.100 100 µg - -

3 - 19 business days*

814.00€
 
Hypoxia-inducible factor-2 alpha (HIF-2 alpha) is a transcription factor involved in the... more
Product information "Anti-Hypoxia Inducible Factor 2a (Hypoxia Inducible Factor 2 alpha, Hypoxia-inducible Factor 2-alpha"
Hypoxia-inducible factor-2 alpha (HIF-2 alpha) is a transcription factor involved in the induction of oxygen regulated genes. HIF-2 alpha binds to a specific core DNA sequence within the hypoxia response element of target gene promoters. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. , Recommended Dilution: Western Blot: 1ug/ml, Immunohistochemistry (Paraffin and Formalin): 0.5-1ug/ml, Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: Anti-Hypoxia-inducible factor 2-alpha, Anti-Endothelial PAS domain-containing protein 1
Supplier: United States Biological
Supplier-Nr: H9810-01R

Properties

Application: IHC, WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: rat
Immunogen: Synthetic peptide corresponding to aa202-240, YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD to rat Hypoxia-inducible factor-2 alpha.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Hypoxia Inducible Factor 2a (Hypoxia Inducible Factor 2 alpha, Hypoxia-inducible Factor 2-alpha"
Write a review
or to review a product.
Viewed