Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| 128163.100 | 100 µg | - | - |
3 - 19 business days* |
850.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
This gene encodes a serine protease. The protein has been localized in the endoplasmic reticulum... more
Product information "Anti-HTRA2 (OMI, PRSS25, Serine Protease HTRA2, Mitochondrial, High Temperature Requirement Protein"
This gene encodes a serine protease. The protein has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed. Alternate splicing of this gene results in two transcript variants encoding different isoforms. Additional transcript variants have been described, but their full-length sequences have not been determined. [provided by RefSeq]. Applications: Suitable for use in ELISA, Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 30ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: RRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
| Supplier: | United States Biological |
| Supplier-Nr: | 128163 |
Properties
| Application: | ELISA, IF, WB |
| Antibody Type: | Monoclonal |
| Clone: | 4F10 |
| Conjugate: | No |
| Host: | Mouse |
| Species reactivity: | human |
| Immunogen: | Partial recombinant corresponding to aa359-458 from human HTRA2 (AAH00096) with GST tag. MW of the GST tag alone is 26kD. |
| Purity: | Purified by Protein A affinity chromatography. |
| Format: | Affinity Purified |
Database Information
| KEGG ID : | K08669 | Matching products |
| UniProt ID : | O43464 | Matching products |
| Gene ID : | GeneID 27429 | Matching products |
Handling & Safety
| Storage: | -20°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed