Anti-HMGB1 (High Mobility Group Protein B1, High Mobility Group Protein 1, HMG-1, HMG1)

Anti-HMGB1 (High Mobility Group Protein B1, High Mobility Group Protein 1, HMG-1, HMG1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
127955.100 100 µg - -

3 - 19 business days*

715.00€
 
DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds... more
Product information "Anti-HMGB1 (High Mobility Group Protein B1, High Mobility Group Protein 1, HMG-1, HMG1)"
DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 127955

Properties

Application: ELISA, IF, IHC, WB
Antibody Type: Monoclonal
Clone: 1D5
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Full length recombinant corresponding to aa1-215 from human HMGB1 (AAH03378.1) with GST tag. MW of the GST tag alone is 26kD.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-HMGB1 (High Mobility Group Protein B1, High Mobility Group Protein 1, HMG-1, HMG1)"
Write a review
or to review a product.
Viewed