Anti-HMGB1 (High Mobility Group Protein B1, High Mobility Group Protein 1, HMG-1, HMG1)

Anti-HMGB1 (High Mobility Group Protein B1, High Mobility Group Protein 1, HMG-1, HMG1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
127954.100 100 µl - -

3 - 19 business days*

761.00€
 
DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds... more
Product information "Anti-HMGB1 (High Mobility Group Protein B1, High Mobility Group Protein 1, HMG-1, HMG1)"
DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells. Applications: Suitable for use in Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 127954

Properties

Application: IP
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Full length human HMGB1, aa1-215 (NP_002119.1).
Purity: Serum
Format: Serum

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-HMGB1 (High Mobility Group Protein B1, High Mobility Group Protein 1, HMG-1, HMG1)"
Write a review
or to review a product.
Viewed