Anti-HDGF

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59655.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Isoform 1: Acts as a transcriptional repressor (PubMed:17974029). Has mitogenic... more

Close menu

Product information "Anti-HDGF"

Protein function: Isoform 1: Acts as a transcriptional repressor (PubMed:17974029). Has mitogenic activity for fibroblasts (PubMed:11751870, PubMed:26845719). Heparin-binding protein (PubMed:15491618). [The UniProt Consortium]

Keywords:	Anti-HDGF, Anti-HMG1L2, Anti-HMG-1L2, Anti-Hepatoma-derived growth factor, Anti-High mobility group protein 1-like 2
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59655

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to aa. 61-97 of Human HDGF. (KDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKA)
MW:	27 kD
Format:	Antigen Affinity Purified