Anti-HDAC6 (Histone Deacetylase 6, HD6, KIAA0901, JM21)

Anti-HDAC6 (Histone Deacetylase 6, HD6, KIAA0901, JM21)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
127768.100 100 µg - -

3 - 19 business days*

715.00€
 
HDAC6 (histone deacetylase 6) is responsible for the deacetylation of lysine residues on the... more
Product information "Anti-HDAC6 (Histone Deacetylase 6, HD6, KIAA0901, JM21)"
HDAC6 (histone deacetylase 6) is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. HDAC6 plays a central role in microtubule-dependent cell motility via deacetylation of tubulin, and has been shown to interact with HDAC11, SIRT2, and F-actin. HDAC6 is ubiquitinated, but its polyubiquitination however does not lead to degradation. HDAC is also a potential target of sumoylation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHPH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 127768

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 1E2
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Partial recombinant corresponding to aa1128-1215 from HDAC6 (NP_006035) with GST tag. MW of the GST tag alone is 26kD.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-HDAC6 (Histone Deacetylase 6, HD6, KIAA0901, JM21)"
Write a review
or to review a product.
Viewed