Anti-GRIN1 / NMDAR1

Anti-GRIN1 / NMDAR1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4092 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Glutamate [NMDA] receptor subunit zeta-1... more
Product information "Anti-GRIN1 / NMDAR1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Glutamate [NMDA] receptor subunit zeta-1 is a protein that in humans is encoded by the GRIN1 gene. The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described. Protein function: Component of NMDA receptor complexes that function as heterotetrameric, ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Channel activation requires binding of the neurotransmitter glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by Mg(2+) (PubMed:7685113, PubMed:28126851, PubMed:26919761, PubMed:26875626, PubMed:28105280). Sensitivity to glutamate and channel kinetics depend on the subunit composition (PubMed:26919761). [The UniProt Consortium]
Keywords: Anti-GRIN1, Anti-GluN1, Anti-NMD-R1, Anti-NMDAR1, Anti-Glutamate receptor ionotropic, NMDA 1, Anti-Glutamate [NMDA] receptor subunit zeta-1, Anti-N-methyl-D-aspartate receptor subunit NR1, GRIN1 Antibody / NMDAR1
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4092

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Amino acids FIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK from the human protein were used as the immunogen for the GRIN1 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GRIN1 / NMDAR1"
Write a review
or to review a product.
Viewed